DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and LALBA

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001371279.1 Gene:LALBA / 3906 HGNCID:6480 Length:142 Species:Homo sapiens


Alignment Length:128 Identity:42/128 - (32%)
Similarity:66/128 - (51%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALALAAPA-LGRTMDRCSLAREMSNL----GVPRDQLARWACIAEHESSYRTGVVGP 60
            |:.|:.|..:.:..|| |.:...:|.|::.:.::    |:...:|   .|...|.|.|.|..: .
Human     1 MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPEL---ICTMFHTSGYDTQAI-V 61

  Fly    61 ENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAW 123
            || |.|.:||:|||::..||.......|.|.|.:||:..|.||||..:.||:|:|..:|...|
Human    62 EN-NESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 36/109 (33%)
LALBANP_001371279.1 Lys 20..138 CDD:395016 36/109 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.918296 Normalized mean entropy S7122
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.