DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and CG16756

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:131 Identity:44/131 - (33%)
Similarity:65/131 - (49%) Gaps:18/131 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVALALAAPALGRTMDRCSLARE-MSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDY 69
            :|:|:.....:..|.: ||.|||: :...|..|..|:.|.|:.||||...||.: ..|.|||.:|
  Fly    18 LLLAIECGVVSAKRFL-RCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRI-TTNANGSRNY 80

  Fly    70 GIFQINDYYWCAPPSGRFSYNE-----CGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTW-HY 128
            |:||||         |||....     |...|...|.:::..||.||:::.:..|:..|:.| .|
  Fly    81 GLFQIN---------GRFCQEGRRGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRY 136

  Fly   129 C 129
            |
  Fly   137 C 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 42/118 (36%)
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 42/119 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.