DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Spaca5

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001101528.1 Gene:Spaca5 / 314431 RGDID:1584964 Length:160 Species:Rattus norvegicus


Alignment Length:147 Identity:48/147 - (32%)
Similarity:76/147 - (51%) Gaps:20/147 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPENYNGS 66
            :|::|..|.|....:..:||.|||::...|:...:   :..|.|:|.:||.:.|..| ..|.:||
  Rat     8 VVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFV-DHNPDGS 71

  Fly    67 NDYGIFQINDYYWC----APPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAWSTW 126
            ::|||||:|..:||    .|     :.|.|.:.||.||...|...:.||::|: |.:...||.:|
  Rat    72 SEYGIFQLNSAWWCNNGITP-----TQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAWDSW 131

  Fly   127 -HYCSG-----WLPSID 137
             .:|:|     ||...|
  Rat   132 TRHCAGHDLSEWLKGCD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 44/133 (33%)
Spaca5NP_001101528.1 LYZ_C 22..147 CDD:340383 43/130 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.