DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Spaca3

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:152 Identity:51/152 - (33%)
Similarity:75/152 - (49%) Gaps:24/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVALA-----LAAPALGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPE 61
            |..:|||     |.|.:..:...||.||:.:.:.|:...:   ||.|.|:|.:.|.:.|..|..|
  Rat    17 ITWLALAYLLSCLLASSKAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAVDHE 81

  Fly    62 NYNGSNDYGIFQINDYYWC--APPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAW 123
             .:||.:.|||||:...||  ..|:|.   |.|.:.|..||::|:..||.|..|:..: ||...|
  Rat    82 -ADGSTNNGIFQISSRKWCKNLAPNGP---NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYW 142

  Fly   124 STW-HYCSG-----WLPSIDDC 139
            .:| |:|.|     |   :|.|
  Rat   143 ESWKHHCQGRDLSDW---VDGC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 44/131 (34%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 44/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347566
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.