DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Lalba

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_034809.1 Gene:Lalba / 16770 MGIID:96742 Length:143 Species:Mus musculus


Alignment Length:130 Identity:46/130 - (35%)
Similarity:71/130 - (54%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIVLVALALAAPALGRT-MDRCSLAREMSNL-GVPRDQLARWACIAEHESSYRTGVVGPENYNGS 66
            |:|.:   |:.||...| :.:|.::..:.:: |.....|..|||:..|.|.|.|..|  .|.|||
Mouse     8 FLVCI---LSLPAFQATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAV--VNDNGS 67

  Fly    67 NDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTWH-YCS 130
            .:||:|||:|.:||.......|.|.||:||:.||.|::...:.||:|:|:.:|...|..:. .||
Mouse    68 TEYGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCS 132

  Fly   131  130
            Mouse   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 41/115 (36%)
LalbaNP_034809.1 Lys 21..138 CDD:333808 41/114 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844186
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.918296 Normalized mean entropy S7122
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.