DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and LYZL4

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001291315.1 Gene:LYZL4 / 131375 HGNCID:28387 Length:146 Species:Homo sapiens


Alignment Length:151 Identity:45/151 - (29%)
Similarity:75/151 - (49%) Gaps:19/151 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIVLVALA-LAAPALGRTMDRCSLAREMSNLGVPRDQ---LARWACIAEHESSYRTGVVGPE 61
            |||.:||..|. |..|:....:.||::|:::.:.|:...:   |..|.|:|..||.:....:...
Human     1 MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYEN 65

  Fly    62 NYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVL-SQQGWSAWST 125
            ...|...:|:||:....||    |....|.|.:||:|||..::..:::||:.:: .::|..||.|
Human    66 TREGYTGFGLFQMRGSDWC----GDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPT 126

  Fly   126 W-HYC------SGWLPSIDDC 139
            | .||      :.||   |.|
Human   127 WSRYCQYSDTLARWL---DGC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 36/130 (28%)
LYZL4NP_001291315.1 LYZ_C 21..144 CDD:340383 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.