DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9119 and 4931406C07Rik

DIOPT Version :9

Sequence 1:NP_612081.1 Gene:CG9119 / 38124 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001186413.1 Gene:4931406C07Rik / 70984 MGIID:1918234 Length:315 Species:Mus musculus


Alignment Length:312 Identity:148/312 - (47%)
Similarity:200/312 - (64%) Gaps:5/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFLL 79
            |...::|.|.||..|:|..|..|||:|.|||..||||..:.|.....|:.|:..:.|.||.|:||
Mouse     5 EFSFHMPSLEELAEVLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLL 69

  Fly    80 PLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGI-FNLSVNEKDELTNGSYTATV 143
            |||.:.|:|::.||.:.|:.|| .|.:||||||:...|.|.|.: ...:.:|.::..||||.|..
Mouse    70 PLVNKKKVYDLNEIAKVIKLPG-AFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHK 133

  Fly   144 RGEQEECVLEKI--PHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHYGD 206
            ......|:|||.  .:.:..||||.|||.|:|:||:|:::.||:||||.||:.|:|:.||.||||
Mouse   134 NPADGACLLEKYSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD 198

  Fly   207 KVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLDLR 270
            |.||:||.|:::||....|:| .:||..|:||||.||:||.||||.|.|..:...|:|:..||||
Mouse   199 KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDPGLDLR 263

  Fly   271 LQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            |:|.|.||....|||||||||||.|||..|.:.|:.:.|:|:|..||..|||
Mouse   264 LEHTHFFSHHGEGGHYHYDTTPDTVEYLGYFSPAQFLYRIDQPKETHAFGRD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 134/282 (48%)
4931406C07RikNP_001186413.1 DUF1907 14..304 CDD:341210 138/290 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849331
Domainoid 1 1.000 257 1.000 Domainoid score I2006
eggNOG 1 0.900 - - E1_KOG4048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8531
Inparanoid 1 1.050 282 1.000 Inparanoid score I2866
Isobase 1 0.950 - 0 Normalized mean entropy S3572
OMA 1 1.010 - - QHG52343
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006469
OrthoInspector 1 1.000 - - otm43511
orthoMCL 1 0.900 - - OOG6_107407
Panther 1 1.100 - - LDO PTHR13204
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3978
SonicParanoid 1 1.000 - - X4717
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.