DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9119 and c11orf54

DIOPT Version :9

Sequence 1:NP_612081.1 Gene:CG9119 / 38124 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001016346.2 Gene:c11orf54 / 549100 XenbaseID:XB-GENE-1010634 Length:316 Species:Xenopus tropicalis


Alignment Length:313 Identity:144/313 - (46%)
Similarity:196/313 - (62%) Gaps:5/313 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EEKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFL 78
            |....:||.|.|:.:|::..|..|||:|:|.|..||||..:.|.....||.||..:.:.||.|:|
 Frog     5 ENCSFHVPSLEEICSVLKSGLLKNFADVSVIVTECPDLSKEPFEFPVKGLCGKSRIADVGGVPYL 69

  Fly    79 LPLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGIFNLSV-NEKDELTNGSYTAT 142
            :|..:.||:||:..:.:||..|| .:.:||||......|.|.|.||::.. ||..:..|.||.|:
 Frog    70 VPKPRLDKVYNVNAVAKKIGLPG-AYILGAGATSHKSLGMNAELIFSVQAENESIQAVNKSYVAS 133

  Fly   143 VRGEQEECVLEKI--PHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHYG 205
            |......|:|||.  .:.:....||.||:..:||||:|::::.|:|.|:.||:.|:||.|:.|||
 Frog   134 VNPGDGSCLLEKYRDRNNDNDFGLLSNLYACEGKPGKVIEVSVKRRIGQDNFVSCMRKSLKTHYG 198

  Fly   206 DKVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLDL 269
            :|.|||||.||:|:|.|..||| |::|..|:|:||:||.|||||||.|.|......|:.:...||
 Frog   199 EKAVGLGGTFLLKEGKAKLHVMPREYSACPLNTDEDVNGWLKFYEMKAPLICQSVFVSHDPGYDL 263

  Fly   270 RLQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            ||:|.|.||....|||||||||||.|||..|.:.||.:.|:|||.|||.||||
 Frog   264 RLEHTHCFSHHGEGGHYHYDTTPDTVEYLGYFHPAELLYRIDKPSATHMVGRD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 127/282 (45%)
c11orf54NP_001016346.2 DUF1907 22..304 CDD:286069 127/282 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2140
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8531
Inparanoid 1 1.050 276 1.000 Inparanoid score I2875
OMA 1 1.010 - - QHG52343
OrthoDB 1 1.010 - - D375938at33208
OrthoFinder 1 1.000 - - FOG0006469
OrthoInspector 1 1.000 - - otm48664
Panther 1 1.100 - - LDO PTHR13204
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3978
SonicParanoid 1 1.000 - - X4717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.