DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9119 and RGD1309534

DIOPT Version :9

Sequence 1:NP_612081.1 Gene:CG9119 / 38124 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001014228.1 Gene:RGD1309534 / 363016 RGDID:1309534 Length:315 Species:Rattus norvegicus


Alignment Length:312 Identity:150/312 - (48%)
Similarity:199/312 - (63%) Gaps:5/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFLL 79
            |...:||.|.||..|:|..|..|||:|.|||..||||..:.|.....|:.|:..:.|.||.|:||
  Rat     5 EFSFHVPSLEELAEVLQKGLKDNFAHVQVSVVDCPDLTKEPFTFPVKGICGQTRIAEVGGVPYLL 69

  Fly    80 PLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGI-FNLSVNEKDELTNGSYTATV 143
            |||.:.|:|::.||.::|:.|| .|.:||||||:...|.|.|.: ...:.:|..:..||||.|..
  Rat    70 PLVNKKKVYDLNEIAKEIKLPG-AFILGAGAGPFQTLGFNSEFMPIVQTASEHHQPVNGSYFARA 133

  Fly   144 RGEQEECVLEKIPHTEP--RCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHYGD 206
            .....:|:|||.....|  .||||.|||.|:|:||:|:::.||:||||.||:.|:|:.||.||||
  Rat   134 NPADGKCLLEKYSQKYPDFGCALLANLFASEGQPGKVIEVQAKKRTGEHNFVSCMRQTLEKHYGD 198

  Fly   207 KVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLDLR 270
            |.||:||.||::||....|:| .:||...:||||.||:||.||||.|.|..:...|:|:..||||
  Rat   199 KPVGMGGTFLVQKGKVKAHIMPAEFSSCSLNSDEAVNQWLNFYEMKAPLVCLPVFVSKDPGLDLR 263

  Fly   271 LQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            |:|.|.||....|||||||||||.|||..|.:.|:.:.|:|:|..||..|||
  Rat   264 LEHTHFFSHHGEGGHYHYDTTPDTVEYLGYFSPAQFLYRIDQPKETHAFGRD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 135/282 (48%)
RGD1309534NP_001014228.1 DUF1907 14..304 CDD:341210 139/290 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352946
Domainoid 1 1.000 260 1.000 Domainoid score I1904
eggNOG 1 0.900 - - E1_KOG4048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8531
Inparanoid 1 1.050 287 1.000 Inparanoid score I2753
OMA 1 1.010 - - QHG52343
OrthoDB 1 1.010 - - D375938at33208
OrthoFinder 1 1.000 - - FOG0006469
OrthoInspector 1 1.000 - - otm45576
orthoMCL 1 0.900 - - OOG6_107407
Panther 1 1.100 - - LDO PTHR13204
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4717
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.