DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and LYZL1

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 / 84569 HGNCID:30502 Length:185 Species:Homo sapiens


Alignment Length:125 Identity:48/125 - (38%)
Similarity:67/125 - (53%) Gaps:11/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLALVTPAVLG---RTMDRCSLAREMANMGVSR---DQLSKWACIAEHESSYRTGVVGPPNTDGS 67
            :|.|:...|.|   :...||.||:..:..|:..   ..|..|.|:|.:||.|.| .......|||
Human    52 ILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNT-TAQTVLDDGS 115

  Fly    68 NDYGIFQINDMYWCQPSSGKFSHNG-CDVSCNALLTDDIKSSVRCALKVLGQ-QGWSAWS 125
            .||||||||...||:  .||...|. |.|:|:||:|||:..::.||.|::.: ||.:.||
Human   116 IDYGIFQINSFAWCR--RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 44/111 (40%)
LYZL1XP_005252684.1 LYZ1 66..172 CDD:238066 42/108 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.