DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and 9530003J23Rik

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_084182.2 Gene:9530003J23Rik / 77397 MGIID:1924647 Length:151 Species:Mus musculus


Alignment Length:127 Identity:48/127 - (37%)
Similarity:73/127 - (57%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGICVLALVTPAVLGRTMDRCSLAREMANMGVSRDQ---LSKWACIAEHESSYRTGVVGPPNTDG 66
            ||:.:|::   .:.|:..|||||||.:.::|::..|   |:.|.|:|:.||::.|........|.
Mouse    10 LGLLLLSI---TIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTRFNPEDQ 71

  Fly    67 SNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVL-GQQGWSAWSTW 127
            |..|||||||..:||.......|.|.|.:||.|||..:|.|:|.||.::: ..||..:|:.|
Mouse    72 STSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIYSWAGW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 44/112 (39%)
9530003J23RikNP_084182.2 LYZ1 22..147 CDD:238066 44/112 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844174
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.