DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and Lyzl6

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 / 69444 MGIID:1916694 Length:148 Species:Mus musculus


Alignment Length:137 Identity:52/137 - (37%)
Similarity:67/137 - (48%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRALLGICVLALVTPAVLGRTMDRCSLAR---EMANMGVSRDQLSKWACIAEHESSYRTGVVGPP 62
            |...|.|||.:.:.....|..:.|||||:   |....|.....|..|.|:|..||::....|. .
Mouse     1 MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVN-E 64

  Fly    63 NTDGSNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVL-GQQGWSAWST 126
            |.|||.||||||||..|||.... ..|.|.|.|.|..||:.::.|::.||.|:: |..|...|..
Mouse    65 NVDGSFDYGIFQINSRYWCNDYQ-SHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVE 128

  Fly   127 WH-YCSG 132
            |. :|.|
Mouse   129 WKLHCLG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 46/118 (39%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 46/117 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844154
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 1 0.950 - 0 Normalized mean entropy S6989
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.