DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and Lyc2

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001381322.1 Gene:Lyc2 / 688047 RGDID:1593616 Length:148 Species:Rattus norvegicus


Alignment Length:147 Identity:57/147 - (38%)
Similarity:81/147 - (55%) Gaps:17/147 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRALLGICVLALVTPAVLGRTMDRCSLAREMAN------MGVSRDQLSKWACIAEHESSYRTGVV 59
            |:|||.:..| |::.:|..:....|.|||.:.:      .|||   |..|.|:|:|||::.|..:
  Rat     1 MKALLVLGFL-LLSASVQAKVFKHCELARILRSSALAGYRGVS---LENWMCMAQHESNFDTEAI 61

  Fly    60 GPPNTDGSNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVL-GQQGWSA 123
            ...:||.|.||||||||..|||.......:.|.|.:.|:|||.|||..:::||.:|: ..||..|
  Rat    62 NYNSTDQSTDYGIFQINSRYWCNDGKTPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRA 126

  Fly   124 WSTW-HYC-----SGYL 134
            |..| .:|     |||:
  Rat   127 WVAWQRHCQNRDLSGYI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 50/128 (39%)
Lyc2NP_001381322.1 LYZ1 19..147 CDD:197612 50/128 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347539
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.