DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and MGC89221

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001004951.1 Gene:MGC89221 / 448362 XenbaseID:XB-GENE-5851163 Length:140 Species:Xenopus tropicalis


Alignment Length:133 Identity:46/133 - (34%)
Similarity:65/133 - (48%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICVLALVTPAVLGRT--MDRCSLAREMAN---MGVSRDQLSKWACIAEHESSYRTGVVGPPNTDG 66
            |.||.::|.|....:  :||||:.|.:.|   :|:....|..:.|:|...|.|.|.:...|    
 Frog     3 IFVLLMITAAFAAHSWALDRCSVVRAIRNGGVIGIKGYTLGDYVCLAYQASRYDTSLNRSP---- 63

  Fly    67 SNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVL-GQQGWSAWSTW-HY 129
             .:|||||||..:||.........|.|.:||.:||..:|...|||..::: ...|..|||.| .|
 Frog    64 -TEYGIFQINSYWWCDDGRTVGRKNLCGMSCRSLLNSNIGDDVRCLRRIVRDPNGLDAWSVWTRY 127

  Fly   130 CSG 132
            |.|
 Frog   128 CKG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 41/120 (34%)
MGC89221NP_001004951.1 LYZ1 20..136 CDD:238066 41/116 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.