DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and SPACA5

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001381227.1 Gene:SPACA5 / 389852 HGNCID:31353 Length:159 Species:Homo sapiens


Alignment Length:140 Identity:48/140 - (34%)
Similarity:75/140 - (53%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GICVLALVTPAVL---GRTMDRCSLAREMANMGVSRDQ---LSKWACIAEHESSYRTGVVGPPNT 64
            |..|:.|.|..|:   .:..:||.||..:...|::..:   :..|.|:|.:||.:.|..| ..|.
Human     5 GTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFV-DHNP 68

  Fly    65 DGSNDYGIFQINDMYWCQ----PSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVL-GQQGWSAW 124
            |||::|||||:|..:||.    |:.     |.|.:.|:.||...|...:|||.::: .|.|.|||
Human    69 DGSSEYGIFQLNSAWWCDNGITPTK-----NLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAW 128

  Fly   125 STWH-YCSGY 133
            ::|. :|||:
Human   129 TSWRLHCSGH 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 43/123 (35%)
SPACA5NP_001381227.1 LYZ_C 22..147 CDD:340383 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.