DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and CG16799

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:126 Identity:38/126 - (30%)
Similarity:57/126 - (45%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICVLALVTPAVLGRTMDRCSLAREMA-NMGVSRDQLSKWACIAEHESSYRTGVVGPPNTDGSNDY 70
            :.:|.|....|..:...||.|.|.:. |....:..:|.|.|:.||||...|..|.....:..| |
  Fly    28 LILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTKKGNESKN-Y 91

  Fly    71 GIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVLGQQGWSAWSTW-HYC 130
            |:||||...:|  |.|: ....|::.|.....|||...:.||..:..::|:..|..| .:|
  Fly    92 GLFQINSKDYC--SEGR-KGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKGWDRFC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 35/113 (31%)
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
65.850

Return to query results.
Submit another query.