DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and Spaca5

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:142 Identity:45/142 - (31%)
Similarity:73/142 - (51%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICVLALVTPAVL------GRTMDRCSLAREMANMGVSRDQ---LSKWACIAEHESSYRTGVVGPP 62
            :|.:.:|..|||      .:..:||.||:::...|:...:   :..|.|:|.:||.:.|..| ..
Mouse     3 VCSIVVVILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFV-DH 66

  Fly    63 NTDGSNDYGIFQINDMYWCQ----PSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVL-GQQGWS 122
            |.|||::|||||:|..:||.    |     :.|.|::.||.||...|...:.||.:|. ..:...
Mouse    67 NPDGSSEYGIFQLNSAWWCNNGITP-----TQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMK 126

  Fly   123 AWSTW-HYCSGY 133
            ||.:| .:|:|:
Mouse   127 AWDSWTQHCAGH 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 40/123 (33%)
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 40/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844214
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.