DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and SPACA3

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens


Alignment Length:131 Identity:42/131 - (32%)
Similarity:67/131 - (51%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICVLALVTPAVLGRTMDRCSLAREMANMGVSRDQ---LSKWACIAEHESSYRTGVVGPPNTDGSN 68
            :|:|:.:.|:...:...||.|||.:.:.|:...:   |:.|.|:|...|.:....: ....|||.
Human    75 VCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAAL-DYEADGST 138

  Fly    69 DYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVLGQ-QGWSAWSTW-HYCS 131
            :.||||||...||...:.... |.|.:.|:.||..::|.:|.||:|:..: ||...|..| |:|.
Human   139 NNGIFQINSRRWCSNLTPNVP-NVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQ 202

  Fly   132 G 132
            |
Human   203 G 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 39/118 (33%)
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.