DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysX and LOC100493166

DIOPT Version :9

Sequence 1:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_031750467.1 Gene:LOC100493166 / 100493166 -ID:- Length:121 Species:Xenopus tropicalis


Alignment Length:124 Identity:40/124 - (32%)
Similarity:60/124 - (48%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICVLALVTPAVLGRT--MDRCSLAREMAN---MGVSRDQLSKWACIAEHESSYRTGVVGPPNTDG 66
            ||::.:|..|:.|.:  :|:||:.....|   .|:...:|..:.|:|.|.|.|.|.:...|    
 Frog     3 ICLMIVVAAALAGNSWALDKCSVVEAFRNSGLAGIKGYKLEDFVCLAYHASRYDTSLHRSP---- 63

  Fly    67 SNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVLGQ-QGWSAW 124
             .:|||||||..:||.........|.|.:.|..||..||:..|||..:::.. .|..||
 Frog    64 -TEYGIFQINSYWWCDDGKTPGRKNWCRMPCTDLLDTDIEDDVRCVKRIVSDPNGLEAW 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 35/111 (32%)
LOC100493166XP_031750467.1 Lyz-like 20..121 CDD:412234 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.