DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab1 and nacc1

DIOPT Version :9

Sequence 1:NP_728565.1 Gene:bab1 / 38116 FlyBaseID:FBgn0004870 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_001184134.2 Gene:nacc1 / 733749 XenbaseID:XB-GENE-979467 Length:495 Species:Xenopus tropicalis


Alignment Length:318 Identity:73/318 - (22%)
Similarity:119/318 - (37%) Gaps:109/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAETPCQHPIV-IMRDVNWSDL 176
            |..:.:|.||. .:.||::...|...|||:.||:|.|.||:.|...:  ::|:| :...|.....
 Frog    17 LECLNEQRLQG-LYCDVSVVVRGHQFKAHRAVLAASSSYFRDLFHSS--KNPVVELPGSVQPQSF 78

  Fly   177 KAIVEFMYRGEINVS-QDQI-----GPLLRIAEM--------LKV-------RGLADVTHME--- 217
            :.|:.|.|.|.:::: .||.     ...|:|.|:        |||       :||    |.|   
 Frog    79 QQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGL----HPEETP 139

  Fly   218 -------AATAAAAAASSERMPSSPKESTSTSRTEHDREREAEELLAFMQPEKKLRTSDWDPAEL 275
                   |||.||||.::..:.||   |:|:||.                  .|::|...:...:
 Frog   140 GSEPPSPAATVAAAATAAAALASS---SSSSSRA------------------PKVKTESQESEAV 183

  Fly   276 RLSPLERQQGRNVRKRRWPSADTIFNPPAPPSPLSSLIAAERMELEQKERERQRDCSLMTPPPKP 340
            :.:|        |.||.|                         |..|||..     .:....|:.
 Frog   184 QCTP--------VAKRLW-------------------------EGGQKEAG-----GVGRKVPRF 210

  Fly   341 PMSSGSTVGATRRLETAIHALDMPSPAATPGPLS--RSSRP---HSQSPQQQQAQQQG 393
            ....|:.||...::..|      .|...:||..|  .|..|   |::..::::..:.|
 Frog   211 SQGGGAAVGPAGQVAPA------GSERTSPGTSSAYTSDSPGSYHNEEDEEEEVGEDG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab1NP_728565.1 BTB 117..216 CDD:279045 33/120 (28%)
BTB 128..213 CDD:197585 30/106 (28%)
HTH_psq 569..614 CDD:283007
nacc1NP_001184134.2 BTB_POZ_BTBD14B_NAC1 3..125 CDD:349599 32/110 (29%)
BEN 366..444 CDD:214981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5158
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.