DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab1 and lolal

DIOPT Version :10

Sequence 1:NP_728565.1 Gene:bab1 / 38116 FlyBaseID:FBgn0004870 Length:977 Species:Drosophila melanogaster
Sequence 2:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:116 Identity:68/116 - (58%)
Similarity:92/116 - (79%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SSSQQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAETPC 161
            ||.|||.|:||::|||:.|.|..|...:.|.||||||:|::.||||||||||||||:.||.|.|.
  Fly     3 SSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPS 67

  Fly   162 QHPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLAD 212
            :|||:|::||::..|:||:||||.||:||||:|:...|:.|:.|||:|||:
  Fly    68 KHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab1NP_728565.1 BTB_POZ_BAB-like 126..209 CDD:349624 51/82 (62%)
HTH_psq 569..614 CDD:283007
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 51/82 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.