DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab1 and btbd18

DIOPT Version :9

Sequence 1:NP_728565.1 Gene:bab1 / 38116 FlyBaseID:FBgn0004870 Length:977 Species:Drosophila melanogaster
Sequence 2:XP_017951392.1 Gene:btbd18 / 100498010 -ID:- Length:602 Species:Xenopus tropicalis


Alignment Length:120 Identity:35/120 - (29%)
Similarity:55/120 - (45%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 WNNYQTNLTTIFDQLLQNE---CFVDVTL-ACDGRSMKAHKMVLSACSPYFQTLLA--------- 157
            ||  ...|.|:|.||.:.:   .|.|||| ..:|..:..|..:|:|||||...|||         
 Frog    10 WN--PRLLRTMFLQLQRQQNTGFFCDVTLQGGEGEGVSVHACLLAACSPYLAKLLASVTEVSQLD 72

  Fly   158 -----ETPCQHPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKV 207
                 :|.|...|:.:..:....|..:|.:||..|:.|:.:.:..:|..|..|::
 Frog    73 TDSAIQTDCTGHILTVPGIPSCYLLPLVHYMYTSELEVTPENVHGVLEAARRLQI 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab1NP_728565.1 BTB 117..216 CDD:279045 31/109 (28%)
BTB 128..213 CDD:197585 27/95 (28%)
HTH_psq 569..614 CDD:283007
btbd18XP_017951392.1 BTB_POZ_BTBD18 17..148 CDD:349602 32/111 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.