DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and HES1

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_014880.3 Gene:HES1 / 854412 SGDID:S000005763 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:21/117 - (17%)
Similarity:39/117 - (33%) Gaps:48/117 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQV 74
            :|:|...:.||.|..:.::|           |...:|:...|||.     .|:.|:|        
Yeast   260 KENALYLISGQWSGVSTIIK-----------KDSQVSHQFYDSSE-----TPTEHLL-------- 300

  Fly    75 QLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHM 126
                  |.|.:|.                  :...:|:.|.|...|:.:.::
Yeast   301 ------VKPIEEQ------------------HPLESRRAWKDVAEAIRQGNI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 19/107 (18%)
PH_ORP10_ORP11 17..135 CDD:270106 19/110 (17%)
HES1NP_014880.3 Oxysterol_BP 12..365 CDD:395990 21/117 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.