DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and OSH6

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_012928.1 Gene:OSH6 / 853872 SGDID:S000001711 Length:448 Species:Saccharomyces cerevisiae


Alignment Length:157 Identity:29/157 - (18%)
Similarity:49/157 - (31%) Gaps:50/157 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LSKYTNVMK----GWQY--------------RWFTV--DAKTGSLSYYLCDSSTVGDDIAPSPHV 65
            |.::..|||    ||..              .:||.  |......:||:.:.::   ...|....
Yeast   103 LKRFLYVMKWYLAGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAYYISEQTS---HHPPECAY 164

  Fly    66 LASAPRGQVQLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMD 130
            ....|...:::.| ||.|........:.|...|.||                        ::.:|
Yeast   165 FYMIPESSIRVDG-VVIPKSRFLGNSSAAMMDGSTV------------------------LQFLD 204

  Fly   131 ISNSSPLPPRELLAASDAMVSARQALF 157
            |.:.:..|.:.:|...:..|  |..||
Yeast   205 IKDGNGKPEKYVLTQPNVYV--RGILF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 21/121 (17%)
PH_ORP10_ORP11 17..135 CDD:270106 23/133 (17%)
OSH6NP_012928.1 Oxysterol_BP 53..393 CDD:395990 29/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.