DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and AT1G77730

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_177896.1 Gene:AT1G77730 / 844109 AraportID:AT1G77730 Length:265 Species:Arabidopsis thaliana


Alignment Length:206 Identity:51/206 - (24%)
Similarity:82/206 - (39%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYY----------------------------LCDSS 53
            :.|.|.|:.|..:||:.|||.:  :.|.||||                            :|..|
plant    54 VAGILYKWVNYGQGWKRRWFVL--QDGVLSYYRIHGPDKISLSVEMDRRSKLIGGESLRFICRHS 116

  Fly    54 TVGDDIAPSPHVLASAPRGQVQLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGL 118
            ..||..:|      ..|.||:.|..:.:..|..|.:.|.:...: .::.|||..:..|..|::.|
plant   117 KRGDVHSP------GKPLGQIHLKVSSIGQSISDGKRFTVFTGT-KSLHLRAATSEDRASWIEAL 174

  Fly   119 RAVVESHMKAMDISNSSPLPPRELLAASDAMVSA-----RQALFLTEQCNASLARAIESIDCASF 178
            :||.|:.          |....|.|.||...||.     ||.| :.|:.:.::.:..|.|...:|
plant   175 KAVKETF----------PRMSNEELMASTTNVSVSTDKLRQRL-MEEEVDETIIKDCEDIMKNNF 228

  Fly   179 SPTDPDLLLLK 189
            .....:::.||
plant   229 LALHDEVMSLK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 34/133 (26%)
PH_ORP10_ORP11 17..135 CDD:270106 35/145 (24%)
AT1G77730NP_177896.1 PH-like 54..186 CDD:302622 36/150 (24%)
PH 56..179 CDD:278594 34/131 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2677
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.