DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and Osbpl5

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_077251.1 Gene:Osbpl5 / 79196 MGIID:1930265 Length:898 Species:Mus musculus


Alignment Length:222 Identity:45/222 - (20%)
Similarity:78/222 - (35%) Gaps:62/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NLNRIIRESAKLKLCGQLS-----------KYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGD 57
            ::.|.|||..:.|...:.|           ::...:..|:.:.|.:|..|....|..       :
Mouse   676 HVTRAIREGDQHKATQEKSVLEEAQRQRAREHQQSLTPWKPQLFLLDPLTQEWRYRY-------E 733

  Fly    58 DIAP-SPHVLASAPRGQVQLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVD-GLRA 120
            |::| .|            |.....|..|....|......||.|..|.:.|:|.::...| .||.
Mouse   734 DLSPWDP------------LKDIAQYEQDGILHTLQRETMSGQTTFLGSPDSRHKRPSSDRRLRK 786

  Fly   121 VVE---SHMKAMDISNSSP-----------LP------PR------ELLAASDAMVSARQALFLT 159
            ..:   .|.:..:.|.|:|           :|      ||      .|....:|::|.::|   .
Mouse   787 ASDQPSGHSQVTESSGSTPESCPDLSDEDFVPGGESPCPRCRREVHRLKMLQEAVLSIQEA---Q 848

  Fly   160 EQCNASLARAIESIDCASFSPTDPDLL 186
            ::.:..|:..:.|...|..:|. |.||
Mouse   849 QELHRHLSTMLSSTVRAGQAPA-PSLL 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 23/120 (19%)
PH_ORP10_ORP11 17..135 CDD:270106 24/133 (18%)
Osbpl5NP_077251.1 PH_OPR5_ORP8 144..272 CDD:270103
PH 151..267 CDD:278594
Oxysterol_BP 397..730 CDD:279564 10/53 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.