DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and osbpl9

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001071273.1 Gene:osbpl9 / 777767 ZFINID:ZDB-GENE-061110-103 Length:733 Species:Danio rerio


Alignment Length:107 Identity:43/107 - (40%)
Similarity:55/107 - (51%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP 83
            |.|||:||||||||||||.:|...|.||||           .....::..:.||.|:|.|||:..
Zfish     7 GPLSKWTNVMKGWQYRWFVLDYNAGLLSYY-----------TSKDKMMRGSRRGCVRLRGAVIGI 60

  Fly    84 SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESH 125
            .|||..||.|. ....|...:|.||..|::|:..|...:..|
Zfish    61 DDEDDSTFTIT-VDQKTFHFQARDADEREKWIHALEGTILRH 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 42/103 (41%)
PH_ORP10_ORP11 17..135 CDD:270106 43/107 (40%)
osbpl9NP_001071273.1 PH 4..98 CDD:278594 42/102 (41%)
PH_ORP9 5..106 CDD:241444 43/107 (40%)
PHA02664 <272..370 CDD:177447
Oxysterol_BP 377..725 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.