DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and osbpl11

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_689013.3 Gene:osbpl11 / 560514 ZFINID:ZDB-GENE-081105-135 Length:712 Species:Danio rerio


Alignment Length:241 Identity:81/241 - (33%)
Similarity:113/241 - (46%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAV 80
            |:.|.|.||||::.|||||:|.::.:.|.|.|::.:.|.            ...|||.:.|.|||
Zfish    32 KVDGYLMKYTNLVTGWQYRYFVLNNEAGLLEYFVNEQSR------------NQKPRGSLPLGGAV 84

  Fly    81 VYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISNSSPLPPRELLAA 145
            :.||||||.||.:...||:..||||:||:.||.||..|:...:.|.:||..:| .||..|.|..|
Zfish    85 ISPSDEDSHTFTVNAISGEQYKLRASDAKERQHWVSRLQVCAQHHTEAMGKTN-PPLQSRSLSMA 148

  Fly   146 S-----------------------------------------DAMVSARQALFLTEQCNASLARA 169
            |                                         |.::.||:.:...:..:..|.::
Zfish   149 SQGSGSSPGSQHRISQNSNALLGLSQLQRGSSLYSSRKSLLPDHLLEAREMMTQAQGQHRDLIQS 213

  Fly   170 IESIDCASF-SPTDPDLLLLKAISTASTQCLHQCLGLLQRHQEINQ 214
            ||.:..:.. ||.|.|||||||.|.|:..||..||.:||..|...|
Zfish   214 IEGLPSSQGPSPLDQDLLLLKATSLATMTCLSDCLHILQLQQVARQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 45/106 (42%)
PH_ORP10_ORP11 17..135 CDD:270106 48/117 (41%)
osbpl11XP_689013.3 PH 34..123 CDD:278594 43/100 (43%)
PH_ORP10_ORP11 35..139 CDD:270106 48/116 (41%)
Oxysterol_BP 346..691 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7827
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.