Sequence 1: | NP_612075.1 | Gene: | CG9205 / 38113 | FlyBaseID: | FBgn0035181 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_689013.3 | Gene: | osbpl11 / 560514 | ZFINID: | ZDB-GENE-081105-135 | Length: | 712 | Species: | Danio rerio |
Alignment Length: | 241 | Identity: | 81/241 - (33%) |
---|---|---|---|
Similarity: | 113/241 - (46%) | Gaps: | 55/241 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 KLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAV 80
Fly 81 VYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISNSSPLPPRELLAA 145
Fly 146 S-----------------------------------------DAMVSARQALFLTEQCNASLARA 169
Fly 170 IESIDCASF-SPTDPDLLLLKAISTASTQCLHQCLGLLQRHQEINQ 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9205 | NP_612075.1 | PH | 15..123 | CDD:278594 | 45/106 (42%) |
PH_ORP10_ORP11 | 17..135 | CDD:270106 | 48/117 (41%) | ||
osbpl11 | XP_689013.3 | PH | 34..123 | CDD:278594 | 43/100 (43%) |
PH_ORP10_ORP11 | 35..139 | CDD:270106 | 48/116 (41%) | ||
Oxysterol_BP | 346..691 | CDD:279564 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 89 | 1.000 | Domainoid score | I7827 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |