DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and Osbp

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_477271.1 Gene:Osbp / 42985 FlyBaseID:FBgn0020626 Length:784 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:76/176 - (43%) Gaps:26/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQ 73
            :.|....::.|.|.|:||.:||:|.|||.:  ..|.||||...|.            :....||.
  Fly     9 LAEKGLPEMKGWLLKWTNYIKGYQRRWFVL--SKGVLSYYRNQSE------------INHTCRGT 59

  Fly    74 VQLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISNSSP-- 136
            :.|.||:::  ..||.||.|:.....|..::|.....||.||..|.......::|::......  
  Fly    60 ISLHGALIH--TVDSCTFVISNGGTQTFHIKAGTEVERQSWVTALELAKAKAIRAIECEEEEETE 122

  Fly   137 ----LPPRELLAA----SDAMVSARQALFLTEQCNASLARAIESID 174
                :|.:|:.:.    :|.:.|.|....|..:..|:|.||:..::
  Fly   123 TAHVVPSQEISSVVRDLTDRLESMRTCYDLITKHGAALQRALNDLE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 34/107 (32%)
PH_ORP10_ORP11 17..135 CDD:270106 35/117 (30%)
OsbpNP_477271.1 PH 15..107 CDD:278594 34/107 (32%)
PH_OSBP_ORP4 17..113 CDD:270101 34/111 (31%)
Oxysterol_BP 399..764 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.