DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and CG1513

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster


Alignment Length:107 Identity:37/107 - (34%)
Similarity:51/107 - (47%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP 83
            |.|||:||||||||||:|.:|...|.||||           .....::....||.|:|..|::..
  Fly    26 GTLSKWTNVMKGWQYRFFVLDENAGLLSYY-----------TSKDKMIKGVRRGCVRLKDALIGI 79

  Fly    84 SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESH 125
            .|::..||.|. ....|...:|.....|::||..|...:..|
  Fly    80 DDQEDNTFTIT-VDHKTFHFQARHNEEREQWVRRLEDTIRRH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 36/103 (35%)
PH_ORP10_ORP11 17..135 CDD:270106 37/107 (35%)
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444 37/107 (35%)
PH 25..118 CDD:278594 36/103 (35%)
Oxysterol_BP 421..767 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.