DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and Osbpl10

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038938606.1 Gene:Osbpl10 / 316039 RGDID:1561652 Length:769 Species:Rattus norvegicus


Alignment Length:254 Identity:84/254 - (33%)
Similarity:115/254 - (45%) Gaps:63/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQV 74
            ||.|   |.|.||||||:::|||.|:|.:|.:.|.|.|::.:.         |.|   ..|||.:
  Rat    75 REPA---LEGVLSKYTNLLQGWQNRYFVLDFEAGLLQYFVNEQ---------SKH---QKPRGVL 124

  Fly    75 QLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMD--------- 130
            .|:||:|..|||......:..|:|:..||||.|:|.:|.||..|||..:.||:...         
  Rat   125 SLSGAIVSLSDEAPHMLVVYSANGEMYKLRAADSREKQLWVTQLRACAKYHMETSSKTTPGSRSR 189

  Fly   131 ---------ISNSSPLPPRELLAASDAMVS-----------------------ARQALFLTEQCN 163
                     .|::||...|.|.|.:..:||                       .|:.:...|...
  Rat   190 SLTLLPHGTPSSASPCSQRHLSAGAPGVVSVTRHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQ 254

  Fly   164 ASLARAIESI-DCASFSPTDPDLLLLKAISTASTQCLHQCLGLLQRHQEINQPVAEAVP 221
            .:|..||||: .....:..|.|||||||.|.|:..||.:||.|||      |.|.:|.|
  Rat   255 KNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLTLLQ------QSVRQAGP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 43/107 (40%)
PH_ORP10_ORP11 17..135 CDD:270106 46/135 (34%)
Osbpl10XP_038938606.1 PH_ORP10_ORP11 79..185 CDD:270106 45/117 (38%)
Oxysterol_BP 407..767 CDD:395990
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.