DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and Osbpl11

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001100560.1 Gene:Osbpl11 / 303888 RGDID:1307294 Length:754 Species:Rattus norvegicus


Alignment Length:235 Identity:80/235 - (34%)
Similarity:109/235 - (46%) Gaps:55/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP 83
            |.|.||||::.|||||:|.::.:.|.|.|::.:.|.            ...|||.:||||||:.|
  Rat    74 GYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSR------------NQKPRGTLQLAGAVISP 126

  Fly    84 SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISNSSPLPPRELLAAS-- 146
            |||||.||.:..|||:..||||.||:.||.||..|:...:.|.:|:. .|:.||..|....||  
  Rat   127 SDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIG-KNNPPLKSRSFSLASSG 190

  Fly   147 -----------------------------------DAMVSARQALFLTEQCNASLARAIESIDCA 176
                                               |.:|..|:.:...|.....|.|.||.:..:
  Rat   191 NSPISQRRPSQNAISFFNVGHSKLQSVNKRAHLHPDHLVEVREMMSHAEGQQRDLIRRIECLPAS 255

  Fly   177 S-FSPTDPDLLLLKAISTASTQCLHQCLGLLQ----RHQE 211
            . .|..|.|||:|||.|.|:..||:.|..:||    .||:
  Rat   256 GLLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHASHQK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 47/103 (46%)
PH_ORP10_ORP11 17..135 CDD:270106 50/115 (43%)
Osbpl11NP_001100560.1 PH_ORP10_ORP11 72..178 CDD:270106 50/116 (43%)
PH 74..164 CDD:278594 47/101 (47%)
Oxysterol_BP 380..740 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7390
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.