DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and Osbpl8

DIOPT Version :10

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_780698.2 Gene:Osbpl8 / 237542 MGIID:2443807 Length:889 Species:Mus musculus


Alignment Length:64 Identity:16/64 - (25%)
Similarity:27/64 - (42%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LGSGYRAPNEINPYYEA-LGLYDMASPHAVNTFCDQLEASADQREIMVK---YAKAINGLATDL 133
            :.:|||:.:..:|...| .|...:.:|....|...|..:....||...|   :..::.|.|.||
Mouse    48 VSNGYRSTSPQSPKEGAGTGTDRVNTPGTFRTLVVQQTSLDPPRETWSKKMDFLLSVIGYAVDL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH_ORP10_ORP11 17..135 CDD:270106 16/64 (25%)
Osbpl8NP_780698.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 16/64 (25%)
PH_OPR5_ORP8 142..271 CDD:270103
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..374
Oxysterol_BP 407..753 CDD:460126
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 772..823
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.