| Sequence 1: | NP_612075.1 | Gene: | CG9205 / 38113 | FlyBaseID: | FBgn0035181 | Length: | 224 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_073613.2 | Gene: | OSBPL11 / 114885 | HGNCID: | 16397 | Length: | 747 | Species: | Homo sapiens |
| Alignment Length: | 239 | Identity: | 81/239 - (33%) |
|---|---|---|---|
| Similarity: | 111/239 - (46%) | Gaps: | 55/239 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 GQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP 83
Fly 84 SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISNSSPLPPRELLAAS-- 146
Fly 147 -----------------------------------DAMVSARQALFLTEQCNASLARAIESIDCA 176
Fly 177 S-FSPTDPDLLLLKAISTASTQCLHQCLGLLQ----RHQEINQP 215 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9205 | NP_612075.1 | PH | 15..123 | CDD:278594 | 47/103 (46%) |
| PH_ORP10_ORP11 | 17..135 | CDD:270106 | 50/115 (43%) | ||
| OSBPL11 | NP_073613.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | ||
| PH_ORP10_ORP11 | 61..167 | CDD:270106 | 50/116 (43%) | ||
| PH | 63..153 | CDD:278594 | 47/101 (47%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..188 | 7/30 (23%) | |||
| Oxysterol_BP | 372..732 | CDD:279564 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 689..714 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 93 | 1.000 | Domainoid score | I7559 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG2210 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||