DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and OSBPL10

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_005264900.1 Gene:OSBPL10 / 114884 HGNCID:16395 Length:769 Species:Homo sapiens


Alignment Length:250 Identity:82/250 - (32%)
Similarity:114/250 - (45%) Gaps:60/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQV 74
            ||.|   |.|.||||||:::|||.|:|.:|.:.|.|.|::.:.         |.|   ..|||.:
Human    73 REPA---LEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQ---------SKH---QKPRGVL 122

  Fly    75 QLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDIS------- 132
            .|:||:|..|||......:..|:|:..||||.||:.:|.||..|||..:.||:....|       
Human   123 SLSGAIVSLSDEAPHMLVVYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKSAPSSRSR 187

  Fly   133 -----------NSSPLPPRELLAASDAMVS-----------------------ARQALFLTEQCN 163
                       ::||...|.|...:..:|:                       .|:.:...|...
Human   188 SLTLLPHGTPNSASPCSQRHLSVGAPGVVTITHHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQ 252

  Fly   164 ASLARAIESI-DCASFSPTDPDLLLLKAISTASTQCLHQCLGLLQR--HQEINQP 215
            .:|..||||: .....:..|.|||||||.|.|:..||.:||.|||:  || ..||
Human   253 KNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSVHQ-AGQP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 43/107 (40%)
PH_ORP10_ORP11 17..135 CDD:270106 46/135 (34%)
OSBPL10XP_005264900.1 PH_ORP10_ORP11 77..183 CDD:270106 46/117 (39%)
PH 78..171 CDD:278594 42/104 (40%)
Oxysterol_BP 402..750 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7559
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.