Sequence 1: | NP_612075.1 | Gene: | CG9205 / 38113 | FlyBaseID: | FBgn0035181 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005264900.1 | Gene: | OSBPL10 / 114884 | HGNCID: | 16395 | Length: | 769 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 82/250 - (32%) |
---|---|---|---|
Similarity: | 114/250 - (45%) | Gaps: | 60/250 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 RESAKLKLCGQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQV 74
Fly 75 QLAGAVVYPSDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDIS------- 132
Fly 133 -----------NSSPLPPRELLAASDAMVS-----------------------ARQALFLTEQCN 163
Fly 164 ASLARAIESI-DCASFSPTDPDLLLLKAISTASTQCLHQCLGLLQR--HQEINQP 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9205 | NP_612075.1 | PH | 15..123 | CDD:278594 | 43/107 (40%) |
PH_ORP10_ORP11 | 17..135 | CDD:270106 | 46/135 (34%) | ||
OSBPL10 | XP_005264900.1 | PH_ORP10_ORP11 | 77..183 | CDD:270106 | 46/117 (39%) |
PH | 78..171 | CDD:278594 | 42/104 (40%) | ||
Oxysterol_BP | 402..750 | CDD:279564 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 93 | 1.000 | Domainoid score | I7559 |
eggNOG | 1 | 0.900 | - | - | E1_KOG2210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |