DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and OSBPL8

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_016874257.1 Gene:OSBPL8 / 114882 HGNCID:16396 Length:912 Species:Homo sapiens


Alignment Length:266 Identity:50/266 - (18%)
Similarity:77/266 - (28%) Gaps:104/266 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYTNVMKGWQYRWFTVDAKTGSLSYYLC--DSSTVGD------DIAPSP-----------HVL-- 66
            |....:|.|...|..:  |.|.|..|..  :...||.      :|...|           |.|  
Human   179 KIRGTLKSWTKLWCVL--KPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQ 241

  Fly    67 ----ASAPRGQVQLAGAVVYP-----------SDEDSRTF------AIACA-------------- 96
                ...|:|:.  .|::..|           |:.|.|.:      |:.|:              
Human   242 SIWAVKGPKGEA--VGSITQPLPSSYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEH 304

  Fly    97 ----SGDTVK------LRANDARARQEWVDGLRAVVESHMKAMDI---------------SNSSP 136
                |.|:..      ||||:..:...:......:...|.|..|:               |::..
Human   305 DLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV 369

  Fly   137 LPPRELLAASDAMVSARQ--------------ALFLTEQCNASLARAIESIDCASFSPTDPDLL- 186
            :...|   .||...|.||              ....|||.:..|..|.|:....:.|..:..|: 
Human   370 MGKSE---ESDTDTSERQDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIW 431

  Fly   187 -LLKAI 191
             |||.:
Human   432 TLLKQV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 29/165 (18%)
PH_ORP10_ORP11 17..135 CDD:270106 33/192 (17%)
OSBPL8XP_016874257.1 PH_OPR5_ORP8 165..294 CDD:270103 23/118 (19%)
Oxysterol_BP 430..767 CDD:395990 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.