Sequence 1: | NP_612075.1 | Gene: | CG9205 / 38113 | FlyBaseID: | FBgn0035181 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_789810.2 | Gene: | Osbpl11 / 106326 | MGIID: | 2146553 | Length: | 757 | Species: | Mus musculus |
Alignment Length: | 235 | Identity: | 80/235 - (34%) |
---|---|---|---|
Similarity: | 109/235 - (46%) | Gaps: | 55/235 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 GQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP 83
Fly 84 SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMDISNSSPLPPRELLAAS-- 146
Fly 147 -----------------------------------DAMVSARQALFLTEQCNASLARAIESIDCA 176
Fly 177 S-FSPTDPDLLLLKAISTASTQCLHQCLGLLQ----RHQE 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9205 | NP_612075.1 | PH | 15..123 | CDD:278594 | 47/103 (46%) |
PH_ORP10_ORP11 | 17..135 | CDD:270106 | 50/115 (43%) | ||
Osbpl11 | NP_789810.2 | PH_ORP10_ORP11 | 72..178 | CDD:270106 | 50/116 (43%) |
PH | 74..164 | CDD:278594 | 47/101 (47%) | ||
Oxysterol_BP | 383..743 | CDD:279564 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 93 | 1.000 | Domainoid score | I7533 |
eggNOG | 1 | 0.900 | - | - | E1_KOG2210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |