DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9205 and osbpl10

DIOPT Version :9

Sequence 1:NP_612075.1 Gene:CG9205 / 38113 FlyBaseID:FBgn0035181 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002941862.1 Gene:osbpl10 / 100496082 XenbaseID:XB-GENE-995970 Length:768 Species:Xenopus tropicalis


Alignment Length:230 Identity:70/230 - (30%)
Similarity:107/230 - (46%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GQLSKYTNVMKGWQYRWFTVDAKTGSLSYYLCDSSTVGDDIAPSPHVLASAPRGQVQLAGAVVYP 83
            |.||||||:::|||.|:|.:|..:|.|.||:.::|.            ...|||.:.|:|:|:..
 Frog    93 GVLSKYTNLIQGWQNRYFILDFDSGILQYYVTEASK------------NQKPRGSLSLSGSVISL 145

  Fly    84 SDEDSRTFAIACASGDTVKLRANDARARQEWVDGLRAVVESHMKAMD---------------ISN 133
            |:|......:...:|:..||||.||:.||.|:..|:|..:.|.::..               .||
 Frog   146 SEEAPNVIIVYSTNGEMYKLRAADAKERQFWMTQLQACAKFHSESKSAVSQRARSYSLLPHGTSN 210

  Fly   134 S-SPLPPRELLAASDAMVS-----------------------ARQALFLTEQCNASLARAIESID 174
            | ||...|::..:..::|:                       .::.:...|....:|..||||:.
 Frog   211 SPSPASQRQMTHSGPSIVTVTHHKSPAAARRSKNQNPAQLHEVKEVMAQVEGQQKNLVHAIESLS 275

  Fly   175 -CASFSPTDPDLLLLKAISTASTQCLHQCLGLLQR 208
             ....|..|.|||||||.|.|:..||.:||.|||:
 Frog   276 GSGPLSALDQDLLLLKATSAATLSCLGECLHLLQQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9205NP_612075.1 PH 15..123 CDD:278594 38/103 (37%)
PH_ORP10_ORP11 17..135 CDD:270106 42/131 (32%)
osbpl10XP_002941862.1 PH_ORP10_ORP11 91..197 CDD:270106 39/115 (34%)
Oxysterol_BP 409..766 CDD:366530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7358
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.