DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and STP9

DIOPT Version :9

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:NP_175449.1 Gene:STP9 / 841453 AraportID:AT1G50310 Length:517 Species:Arabidopsis thaliana


Alignment Length:480 Identity:137/480 - (28%)
Similarity:241/480 - (50%) Gaps:34/480 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLTFFLTYSIFSAVLGMLQFGYNTGV---INAPEKNIENFMKDVYKDRY---GEDISEEFIQQLY 66
            |:|.|:..:...|.:|.|.|||:.|:   :.:.|:.:..|..:|.|..:   .|....:|..||.
plant    20 GVTVFVIMTCIVAAMGGLLFGYDLGISGGVTSMEEFLSKFFPEVDKQMHEARRETAYCKFDNQLL 84

  Fly    67 SVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGF-TKVSHSYEMLFLGRFII 130
            .:..|...:..:...|....:..::|||..:.:..|..:.|:....| |.|:    ||.:||.::
plant    85 QLFTSSLYLAALASSFVASAVTRKYGRKISMFVGGVAFLIGSLFNAFATNVA----MLIVGRLLL 145

  Fly   131 GVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVL--GIEQILGTNEGWPILLGL 193
            ||..|......|:|:||:||..:||.|....|:|:|:|:|::.::  |..|:  ...||.:.|||
plant   146 GVGVGFANQSTPVYLSEMAPAKIRGALNIGFQMAITIGILIANLINYGTSQM--AKNGWRVSLGL 208

  Fly   194 AICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIEEM-RAEERAQQSESH 257
            |..||::.:|...|.|::|..:|...:: |:||:.|:::|.:.:|:|:.::: .|.|.|::.:: 
plant   209 AAVPAVIMVIGSFVLPDTPNSMLERGKY-EQAREMLQKIRGADNVDEEFQDLCDACEAAKKVDN- 271

  Fly   258 ISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVV 322
             ....:......||.|:....:...||.:|||.:.:|:..||.:.|..::::..:.:..||:.||
plant   272 -PWKNIFQQAKYRPALVFCSAIPFFQQITGINVIMFYAPVLFKTLGFADDASLISAVITGAVNVV 335

  Fly   323 MTLVSIPLMDRTGRRTLHLYG----LGGMFIFSIFITISF-------LIKEMIDWMSYLSVVATL 376
            .|||||..:||.|||.|.|.|    :....:....|.:.|       |.....||:  |:.:.. 
plant   336 STLVSIYAVDRYGRRILFLEGGIQMIVSQIVVGTLIGMKFGTTGSGTLTPATADWI--LAFICL- 397

  Fly   377 GFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFS 441
             :|..||...|.:.|::.:|:.....||:..||.|.||....|::|..|.:|...::...|..|.
plant   398 -YVAGFAWSWGPLGWLVPSEICPLEIRPAGQAINVSVNMFFTFLIGQFFLTMLCHMKFGLFYFFG 461

  Fly   442 VFLAIFWIFTYKKVPETKNKTFEEI 466
            ..:|:..:|.|..:||||....||:
plant   462 GMVAVMTVFIYFLLPETKGVPIEEM 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS 17..452 CDD:119392 127/455 (28%)
Sugar_tr 18..470 CDD:278511 134/470 (29%)
STP9NP_175449.1 MFS_STP 31..477 CDD:340919 128/458 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.