DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and SLC2A1

DIOPT Version :10

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:NP_006507.2 Gene:SLC2A1 / 6513 HGNCID:11005 Length:492 Species:Homo sapiens


Alignment Length:40 Identity:9/40 - (22%)
Similarity:17/40 - (42%) Gaps:3/40 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GDDRAHFLHNQTTANFESLYEGQGC---DTVFVTPTARTI 164
            ||.....||.:::.:........||   :.|:.|.:.|.:
Human    47 GDPEGSALHEKSSRDLICYCRKGGCNRGEQVYGTCSGRLL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS_GLUT_Class1 15..461 CDD:340989 9/40 (23%)
SLC2A1NP_006507.2 MFS_GLUT_Class1 14..458 CDD:340989 9/40 (23%)
Disordered. /evidence=ECO:0000305|PubMed:30197081 468..492
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.