DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and CG10960

DIOPT Version :9

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:NP_648605.1 Gene:CG10960 / 39458 FlyBaseID:FBgn0036316 Length:539 Species:Drosophila melanogaster


Alignment Length:393 Identity:124/393 - (31%)
Similarity:199/393 - (50%) Gaps:28/393 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GWMANRFGRKGGLLLNNVLGIAGACLMGFTKV--SHSYEMLFLGRFIIGVNCGLNTSLVPMYISE 147
            |::.|..|||..:|.     :....::|:|.:  :.:..||:..|||:|:..|......|||..|
  Fly   146 GFLINMIGRKWTMLF-----LVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTGE 205

  Fly   148 IAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPV---CP 209
            ||...:||.||:..||.:|:|:|....:|    .|....|     |:|...||.||...:   .|
  Fly   206 IAQKEIRGTLGSFFQLMITIGILFVYAVG----AGVKIFW-----LSIICGILPLIFGAIFFFMP 261

  Fly   210 ESPRYLLITKQWEEEARKALRRLRASG-SVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPL 273
            |||.| |::|...|.|.|:::.||... ..|.::.|:|..:| :...:.::....:..|..|..|
  Fly   262 ESPTY-LVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDR-ETKANKVNVWAALNRPVTRKAL 324

  Fly   274 IIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRT 338
            .|.:.:...||..|||||.:|::.:|:.:. |...|::|||.||.:.||.|.||..::|:.|||.
  Fly   325 AISMGLMFFQQVCGINAVIFYASRIFLEAN-TGIEAEWATILIGIMQVVATFVSTLVVDKLGRRI 388

  Fly   339 LHLYGLGGMFIFSIFITISFLIKE----MIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFS 399
            |.|.....|.|.:..|.:.|.:::    .:..:.:|.|.:...|::.|::|.|.:||::..|||:
  Fly   389 LLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFIIMFSIGYGPVPWLMMGELFA 453

  Fly   400 QGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALE-NYTFLPFSVFLAIFWIFTYKKVPETKNKTF 463
            ...:..|.::|...||:..|||...|.::...|. ..||..|:....:..||.|..|||||.|:.
  Fly   454 TDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKGKSL 518

  Fly   464 EEI 466
            .||
  Fly   519 NEI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS 17..452 CDD:119392 115/377 (31%)
Sugar_tr 18..470 CDD:278511 124/393 (32%)
CG10960NP_648605.1 MFS_1 117..474 CDD:284993 105/344 (31%)
MFS 118..508 CDD:119392 115/378 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
32.810

Return to query results.
Submit another query.