DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and CG33282

DIOPT Version :9

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:489 Identity:127/489 - (25%)
Similarity:212/489 - (43%) Gaps:83/489 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YSIFSAVL-GMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVA--VSIFAIG 76
            |.:.:.|: .::.||:..||         .::..........|...:|...|..::  .|:..:.
  Fly    16 YQLLATVIVNIITFGHGVGV---------GWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLD 71

  Fly    77 GMLGGFSGGWMANRFGRKGGLLLNNVLGIAG--ACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTS 139
            .:.|..:...:..|.|||..|.|     :||  ||:......:.:...|:..||:.|...|....
  Fly    72 SLCGNLTIAMLIERAGRKFCLYL-----MAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYL 131

  Fly   140 LVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLIL 204
            :||::|||:|..|:||.|.::..|:|.:|:|..      .||.|...:.::..|||...:...|.
  Fly   132 VVPIFISEVADSNIRGALTSMVMLSVDLGILAG------YILSTYLAYHVVPFLAIILPVAYFIA 190

  Fly   205 LPVCPESPRYLLITKQWEEEARKALRRLRASGSV------EEDIEEMRAEERAQQSE--SHISTM 261
            ..:.||:..||| .|.....|..:.|..|...|.      :.:.||:|....:||:.  :.:|..
  Fly   191 NIMLPETAPYLL-KKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYK 254

  Fly   262 ELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLV 326
            :|...|.|: .....||:.|..||||:.:...|.:.:|.:||...: ...|||.||.:.:|....
  Fly   255 DLTTKPALK-GFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVD-VNTATIIIGLVQIVGVYT 317

  Fly   327 SIPLMDRTGRRTLHL---YGLG-GMFIFSIFITISFLIK--EMID--W-----MSYLSVVATLGF 378
            |..|:|..|||.|.|   .|:| |...|..|   ::|.|  ::.|  |     |..:..||.:|.
  Fly   318 STILVDIVGRRVLMLISTMGVGIGCIAFGCF---TYLAKIYDLSDFNWLPLVLMIIICYVANIGL 379

  Fly   379 V-VFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGI--GFPSMKTALENYTFLPF 440
            : :||         ::..|||....|..|.:::|:  :::..|.|.  .||.|.    :|..:.|
  Fly   380 IGIFF---------LVLVELFPVKIRSLATSLSVI--FLSLLVFGTLKLFPLML----HYWGISF 429

  Fly   441 SVFLA---------IFWIFTYKKVPETKNKTFEE 465
            :::.:         .||:|    :.|||.|:..|
  Fly   430 TMWFSAASALLTFFYFWLF----LQETKGKSMIE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS 17..452 CDD:119392 121/472 (26%)
Sugar_tr 18..470 CDD:278511 126/486 (26%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 120/467 (26%)
MFS_1 53..409 CDD:284993 105/383 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
11.000

Return to query results.
Submit another query.