DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and ght3

DIOPT Version :9

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:NP_592790.1 Gene:ght3 / 2541758 PomBaseID:SPAC1F8.01 Length:555 Species:Schizosaccharomyces pombe


Alignment Length:495 Identity:124/495 - (25%)
Similarity:212/495 - (42%) Gaps:73/495 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IFSAVLGMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAI--GGML 79
            :|.::.|.|| |.:||.|:. ...:.:| :..:.||| ..||..:....:..|:....|  |.:.
pombe    11 VFISMSGWLQ-GADTGSISG-ILGMRDF-QSRFADRY-NPISNSYSYSAWRQALLTGTINAGCLF 71

  Fly    80 GGFSGGWMANRFGRKGGL-LLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPM 143
            |.........|.|:|..: ..:.|..||...|:  |.|. |:..:.:|:.:.||..|..:.|.|.
pombe    72 GAMLSSPFTERIGKKYSICFFSGVYIIAELLLV--TAVP-SWIQVLVGKILAGVGIGALSVLSPG 133

  Fly   144 YISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNE-----GWPILLGLAICPAILQLI 203
            |.||:||..:||.:....|:..|...|::..:.    :||::     .|....|:.:...||.::
pombe   134 YQSEVAPPQIRGAVVATYQIFSTGAALVAACIN----MGTHKLRKTASWRTSFGINMLWGILLMV 194

  Fly   204 LLPVCPESPRYLLITKQWEEEARKALRRLRAS----------GSVEEDIEEMRAEERAQQSESHI 258
            .:...|||||||:...:.||..|........|          .:::.|||...|..:|:..|   
pombe   195 GVLFLPESPRYLIYKGRDEEALRIMCNMAELSPESEIIQTNFNTIKSDIEIEMAGGKARWIE--- 256

  Fly   259 STMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVM 323
                 |....:|....:|.::.|.::..|.|..|||:|.:|..:|:|:  .....:.:|||....
pombe   257 -----IFGKDIRYRTCLGFLVMLFRELIGNNYYFYYATQVFKGTGMTD--IFLPAVILGAINFGT 314

  Fly   324 TLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLI------KEMIDWMSY-----------LS 371
            |..::..:|..|||...::|       :.|.:|.|.|      :::|    |           :.
pombe   315 TFGALYTIDNLGRRNPLIFG-------AAFQSICFFIYAAVGDRKLI----YKNGTSDHRAGSVM 368

  Fly   372 VVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALE--- 433
            :|.:..|:..:....|.:.|:|..|.|....|....::|...||:.||::....|.:..|:.   
pombe   369 IVFSCLFLFSYCCSWGPMGWVIVGETFPIRYRSKCASVATSGNWLGNFMISFFTPFINNAIGFKL 433

  Fly   434 NYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRHN 473
            .|.:...::| :.|.||...|  |||..|.||:..|:..|
pombe   434 GYIYACINLF-SSFMIFFLAK--ETKGLTLEEVNDLYMSN 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS 17..452 CDD:119392 115/472 (24%)
Sugar_tr 18..470 CDD:278511 122/489 (25%)
ght3NP_592790.1 Sugar_tr 9..467 CDD:278511 122/490 (25%)
MFS 10..452 CDD:119392 115/473 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.