DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and K09C4.2

DIOPT Version :9

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:128 Identity:29/128 - (22%)
Similarity:51/128 - (39%) Gaps:28/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 AVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIG----FPSMKTALENYTFLPFSVF 443
            |.|..:|..:...|||.    |||..:........:..||:.    ||.:.:......|:||.:.
 Worm    11 ATGANAIRLLFVTELFP----PSARTVVGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFVPFVIV 71

  Fly   444 LAIFWIFTYKKVPETKNKTFEEILALFRHNNGRSMLNCTNSLEPQSMNSGIEHAALMVSEEKT 506
            ..:|.|:.|:.:|||:.:...:|:                    :||:..:...|:.:.||.|
 Worm    72 QTVFGIYLYRYMPETRGRAVYDII--------------------ESMDKDVASRAVSIDEENT 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS 17..452 CDD:119392 18/72 (25%)
Sugar_tr 18..470 CDD:278511 23/90 (26%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.