DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut1 and LOC103910009

DIOPT Version :9

Sequence 1:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster
Sequence 2:XP_009296669.1 Gene:LOC103910009 / 103910009 -ID:- Length:148 Species:Danio rerio


Alignment Length:155 Identity:53/155 - (34%)
Similarity:80/155 - (51%) Gaps:22/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 MSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTA 431
            |.|:||...:|.:..|.:||..:|:::|.|||.|..||||..:...:||::||.||..||.::.:
Zfish     1 MRYISVACVVGIIAGFCIGPAGVPFLMTGELFKQSHRPSAYIVGGSLNWISNFAVGFVFPFLQMS 65

  Fly   432 LENYTFLPF-----SVFLAIFWIFTYKKVPETKNKTFEEILALFRHNNGRSMLN----CTNSLEP 487
            ...:.:|.|     .|...:|:|     :||||||||.||..||...|...:.|    .:..|..
Zfish    66 AGAFCYLVFCGVCVGVAAYVFFI-----IPETKNKTFLEISELFALRNACEIENQSLVTSAQLAL 125

  Fly   488 QSMNSGIEHAALMV-----SEEKTQ 507
            :.||.   :.||:.     .:|||:
Zfish   126 KKMNG---YGALVTVVDVDKKEKTE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut1NP_612073.2 MFS 17..452 CDD:119392 31/89 (35%)
Sugar_tr 18..470 CDD:278511 41/107 (38%)
LOC103910009XP_009296669.1 Sugar_tr <1..104 CDD:278511 41/107 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291809at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.