DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13905 and CG15712

DIOPT Version :9

Sequence 1:NP_612072.2 Gene:CG13905 / 38107 FlyBaseID:FBgn0035176 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_611131.2 Gene:CG15712 / 36843 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster


Alignment Length:193 Identity:35/193 - (18%)
Similarity:71/193 - (36%) Gaps:19/193 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ELKSVIRQIPVDNIEKLVQTYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQQWITQQLI 110
            :||..:..:|...|..:...|.:.|.:|:..:..:.|......::|:...|:...:..:::..  
  Fly    29 DLKDFVALVPRRRIGFIAARYYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFVNIINYVSDY-- 91

  Fly   111 LSGGG---PKIFDYLELEIK---ILNKYPYWSQIVNGIQGFQAEFVQIYPVQLIRSFLEPSATQT 169
              |.|   ..:.|.|...::   :....|....:...:..|..:.:...|...|.|.:    .|.
  Fly    92 --GSGYDITTLVDSLPTRLRAYQLSRTVPVELMLRRDLNTFLWDVIHSLPRTRIYSLI----AQK 150

  Fly   170 SPQLSELWRRLVALR--PVYERVLATPPGKAITAELQRLGVDVGGVDALIRYQF---GWSNVT 227
            |.|.:|..:...|||  ...|.|......:.:.|.:::|......||.:::..|   .|...|
  Fly   151 SKQSTEFAKLYKALRDKEFKELVQRARLSRDLQAPIKKLSQKSINVDEILQIVFEVISWGPKT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13905NP_612072.2 Ins_allergen_rp 42..214 CDD:284230 30/175 (17%)
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 32/178 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.