DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13905 and jtb

DIOPT Version :9

Sequence 1:NP_612072.2 Gene:CG13905 / 38107 FlyBaseID:FBgn0035176 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_611126.1 Gene:jtb / 36838 FlyBaseID:FBgn0034126 Length:233 Species:Drosophila melanogaster


Alignment Length:187 Identity:38/187 - (20%)
Similarity:72/187 - (38%) Gaps:32/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ELKSVIRQIPVDNIEKLVQTYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQQWI----- 105
            |||...:.||...|:::|..:::.|..|:..|:.:.|.......:::.:.|||..|..::     
  Fly    37 ELKDFEKLIPTVTIDEVVAEHMITDSGFRKAIKFLRSSDFKTLQQRIESLPEVVDLINFVHLNDT 101

  Fly   106 TQQLILSGGGPKIFDYLELEIKILNKYPYW-SQIVNGIQGFQAEFVQIYPVQLIRSFLEPSAT-- 167
            ||:.:      :.:.|.......|.:..|. .|||..:....:||.|:   ....||:....|  
  Fly   102 TQETV------EKYWYRNNTYNRLRRSAYLREQIVLVLLESSSEFTQL---SSFTSFVREILTHL 157

  Fly   168 -------------QTSPQLSELWRRL--VALRPVYERVLATPPGKAITAELQRLGVD 209
                         |.|...::.::.|  ...:...|....|...:::..||.|..:|
  Fly   158 PRDRFVALINEKRQKSALFAKFYQALKSAEFKAKSEAAWKTSNVQSVVQELSRHAID 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13905NP_612072.2 Ins_allergen_rp 42..214 CDD:284230 38/187 (20%)
jtbNP_611126.1 Ins_allergen_rp 33..219 CDD:284230 38/187 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.