DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and AT1G33250

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_174595.1 Gene:AT1G33250 / 840219 AraportID:AT1G33250 Length:548 Species:Arabidopsis thaliana


Alignment Length:298 Identity:68/298 - (22%)
Similarity:104/298 - (34%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LTDSQFASTSITQLEE-------------GASQL--ATEEELALWLHNETRVLCMVLTLPKNHQS 76
            |.|.:|.:.|::::::             |:|||  ..:|.:.||..            |...:.
plant   111 LFDHEFRNRSLSEIDKLDLSMNHLMFGIAGSSQLWERRKELVRLWWK------------PSQMRG 163

  Fly    77 RV---RRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRNHGEDYDW 138
            .|   .:|....|......|.:|....|.......|.|..     |::.:.....:|....:..|
plant   164 HVWLEEQVSPEEGDDSLPPIIVSEDSSRFRYTNPTGHPSG-----LRISRIAMESFRLSLPNVRW 223

  Fly   139 FLKADDDTFVIMENLRFLLYPYDPEAALYFG-----HRFRTTFPQGYMSGGAGYVMS---RDALR 195
            |:..||||...:.||..:|..|||...:|.|     |...:.|......||.|..:|   .:||.
plant   224 FVLGDDDTIFNVHNLLAVLSKYDPSEMVYIGNPSESHSANSYFSHNMAFGGGGIAISYPLAEALS 288

  Fly   196 RLNLFAFNNSQFC----PINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKFMLPTFPT 256
            |::       ..|    |....|:|| :..|:..:||               |||.:   |.|  
plant   289 RIH-------DDCLDRYPKLYGSDDR-LHACITELGV---------------PLSRE---PGF-- 325

  Fly   257 DNWLPKLTFYEPVNETGSTSG-ISFH----YVKIHEFE 289
            ..|..|          |:..| :|.|    :|.||..|
plant   326 HQWDIK----------GNAHGLLSSHPIAPFVSIHHVE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 40/173 (23%)
AT1G33250NP_174595.1 Galactosyl_T 17..548 CDD:304462 68/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.