DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and AT5G12460

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_568279.2 Gene:AT5G12460 / 831121 AraportID:AT5G12460 Length:441 Species:Arabidopsis thaliana


Alignment Length:232 Identity:48/232 - (20%)
Similarity:82/232 - (35%) Gaps:69/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRT-------TF 176
            :::..:|:..::...::..||:..||||...::||...|..|:.:...|.|.....       .|
plant   108 IRLFYSLQESFKKASKETRWFVIGDDDTLFFLDNLVKALDRYNHKKHYYVGMNSENVWSNAIFAF 172

  Fly   177 PQGYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGF--------CLQNVGVVAGDS 233
            ..||  ||.||.:|...:..|    .:|.:.|      ..|.:|.        ||.::|:   |.
plant   173 DMGY--GGGGYALSYPTVVTL----LSNMEEC------IKRYLGVYSDLLSFRCLADLGI---DL 222

  Fly   234 RDEEG-RDRFLPLSLKFMLPTFP------------TDNWLPKLTFYEPVN---ETGSTS------ 276
            ..|:| ....|...:..:|...|            .|...|.:...:.||   ||..|.      
plant   223 TLEKGMHQNDLHGDISGLLSAHPQSPLISLHHFDVIDPIFPGMNRQQSVNHLMETAKTDQSRVLQ 287

  Fly   277 -------------GISFHYVKIHEFEMYEYLLYRLHI 300
                         .:|:.| .:|   :|:.:..|.|:
plant   288 QTICYQRGYNWSVSVSWGY-SVH---IYQSIYPRSHL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 28/121 (23%)
AT5G12460NP_568279.2 Galactosyl_T <126..>184 CDD:304462 19/59 (32%)
Galactosyl_T 167..416 CDD:304462 35/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.