DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and AT4G23490

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_567683.1 Gene:AT4G23490 / 828447 AraportID:AT4G23490 Length:526 Species:Arabidopsis thaliana


Alignment Length:174 Identity:42/174 - (24%)
Similarity:68/174 - (39%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFG-----HRFRTTFPQ 178
            |::.:.:....|...::..||:..||||..:::||..:|..||.|...|.|     |.....|..
plant   188 LRISRIVSETLRLGPKNVRWFVMGDDDTVFVIDNLIRVLRKYDHEQMYYIGSLSESHLQNIFFSY 252

  Fly   179 GYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFL 243
            |...||.|:.:|....:.|:.......|..|....|:|| :..|:..:||               
plant   253 GMAYGGGGFAISYPLAKALSKMQDRCIQRYPALYGSDDR-MQACMAELGV--------------- 301

  Fly   244 PLSLKFMLPTFPTDNWLPKLTFYEPVNETGSTSGISFHYVKIHE 287
            ||:.:.....:.....|..|....||     |..:|.|::.:.|
plant   302 PLTKELGFHQYDVYGNLFGLLAAHPV-----TPFVSMHHLDVVE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 30/111 (27%)
AT4G23490NP_567683.1 Galactosyl_T 109..311 CDD:304462 34/138 (25%)
DUF604 246..499 CDD:282497 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.